ALDH4A1 mouse monoclonal antibody,clone OTI1H10
Applications | IHC, WB |
Reactivities | Human, Dog, Rat, Mouse |
Conjugation | Unconjugated |
ALDH4A1 mouse monoclonal antibody,clone OTI1H10
Applications | IHC, WB |
Reactivities | Human, Dog, Rat, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH4A1 mouse monoclonal antibody,clone OTI1H10
Applications | IHC, WB |
Reactivities | Human, Dog, Rat, Mouse |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
ALDH4A1 mouse monoclonal antibody,clone OTI1H10, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Dog, Rat, Mouse |
Conjugation | Biotin |
USD 509.00
2 Weeks
ALDH4A1 mouse monoclonal antibody,clone OTI1H10, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Dog, Rat, Mouse |
Conjugation | HRP |
Anti-ALDH4A1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 4 family, member A1 |
Anti-ALDH4A1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 4 family, member A1 |
ALDH4A1 mouse monoclonal antibody,clone OTI1H10
Applications | IHC, WB |
Reactivities | Human, Dog, Rat, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ALDH4A1 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ALDH4A1 |
Rabbit Polyclonal Anti-Aldh4a1 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Aldh4a1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: GSGLRWKHASSLKVANEPILAFTQGSPERDALQKALNDLKDQTEAIPCVV |