Products

cDNA Clones (11)
Proteins (5)
Antibodies (3)
Jump to Filters
View as table Download
CDA (NM_001785) Human Over-expression Lysate
LC419748

USD 134.00

In Stock

CDA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CDA Mouse Monoclonal Antibody [Clone ID: 921CT14.2.1]
TA324911

USD 580.00

5 Days

Mouse monoclonal CDA Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
CDA Rabbit Polyclonal Antibody
TA343116

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-CDA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDA antibody: synthetic peptide directed towards the C terminal of human CDA. Synthetic peptide located within the following region: SPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDLQKTQ
CDA CytoSection
TS408922P5

USD 1,174.00

4 Weeks

Transient overexpression of CDA in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack

Other Names CDD
Accession Number NM_001785, NP_001776