Products

View as table Download

Rabbit polyclonal anti-FEN1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FEN1.

Rabbit polyclonal FEN1 Antibody (Center)

Applications IF, WB
Reactivities Human (Predicted: Bovine)
Conjugation Unconjugated
Immunogen This FEN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 243-272 amino acids from the Central region of human FEN1.

Rabbit anti-FEN1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human FEN1

Rabbit Polyclonal Anti-FEN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FEN1 antibody: synthetic peptide directed towards the C terminal of human FEN1. Synthetic peptide located within the following region: PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSL