Products

View as table Download

Rabbit polyclonal SGCG Antibody (Center)

Applications WB
Reactivities Human (Predicted: Bovine)
Conjugation Unconjugated
Immunogen This SGCG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 145-172 amino acids from the Central region of human SGCG.

Rabbit Polyclonal Anti-SGCG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGCG antibody: synthetic peptide directed towards the middle region of human SGCG. Synthetic peptide located within the following region: FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS