Germany
Japan
United Kingdom
China
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Collagen type V purified from Human and Bovine placenta |
Products
View as table Download
Collagen V (COL5A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Conjugation | Biotin |
| Immunogen | Collagen Type V from Human and Bovine placenta. |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Collagen type V purified from Human and Bovine placenta |
Collagen V (COL5A1) goat polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Human type V collagen |
Rabbit Polyclonal Anti-COL5A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL5A1 antibody: synthetic peptide directed towards the N terminal of human COL5A1. Synthetic peptide located within the following region: PGMPANQDTIYEGIGGPRGEKGQKGEPAIIEPGMLIEGPPGPEGPAGLPG |
Rabbit Polyclonal Anti-Collagen Valpha 1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Collagen Valpha 1 Antibody: A synthesized peptide derived from human Collagen Valpha 1 |
Active filters
Target Symbol
- COLLAGEN V
Reactivities
- Human
Families
- Druggable Genome
Pathways
- ECM-receptor interaction