CD203c Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human, Gibbon (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Orangutan, Marmoset (95%); Horse, Rabbit (84%). |
ENPP1 mouse monoclonal antibody,clone OTI8C7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal anti-AOX1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AOX1 |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CD38 mouse monoclonal antibody, clone T16, APC
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | APC |
NAMPT Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NAMPT |
Aldehyde Oxidase (AOX1) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human AOX1 |
Goat Anti-CD38 (aa226-237) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EVHNLQPEKVQT, from the internal region of the protein sequence according to NP_001766.2. |
Rabbit Polyclonal Anti-CD38 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CD38 antibody was raised against synthetic 16 amino acid peptide from internal region of human CD38. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Gorilla (94%); Marmoset (88%). |
Rabbit Polyclonal Anti-PBEF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PBEF1 antibody: synthetic peptide directed towards the C terminal of human PBEF1. Synthetic peptide located within the following region: CSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDL |
NADK Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Visfatin (NAMPT) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Highly pure E.coli derived recombinant Human Visfatin. |
Visfatin (NAMPT) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Highly pure E.coli derived recombinant Human Visfatin. |
Visfatin (NAMPT) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure E.coli derived recombinant Human Visfatin. |
Visfatin (NAMPT) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure E.coli derived recombinant Human Visfatin. |
Rabbit anti CD38 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
