Products

View as table Download

Rabbit Polyclonal Bax Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody

Applications Dot, WB
Reactivities Human (Predicted: Mouse, Rat, Drosophila)
Conjugation Unconjugated
Immunogen This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2.
Modifications Phospho-specific

Rabbit polyclonal anti-GRP78 / HSPA5 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GRP78.

Rabbit polyclonal BAX Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX.

Anti-BAX Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-172 amino acids of human BCL2-associated X protein

Anti-MAP2K1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 15-28 amino acids of human mitogen-activated protein kinase kinase 1

Anti-MAP2K2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 20-34 amino acids of Human mitogen-activated protein kinase kinase 2

Rabbit Polyclonal Anti-IL1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human IL1A

Rabbit Polyclonal Anti-PRKX Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRKX

Rabbit polyclonal MEK2 (MAP2K2) Antibody (Center)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This MEK2 (MAP2K2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-292 amino acids from the Central region of human MEK2 (MAP2K2).

Rabbit Polyclonal ELK1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit polyclonal BAX Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX.

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-NOTCH1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2541-2555 amino acids of Human notch 1

Rabbit Polyclonal Anti-EGR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGR1 antibody: synthetic peptide directed towards the N terminal of human EGR1. Synthetic peptide located within the following region: DNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGGGSNS

Rabbit polyclonal antibody to PRKACA (protein kinase, cAMP-dependent, catalytic, alpha)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 351 of PKA C alpha (Uniprot ID#P17612)