Products

Jump to Filters
View as table Download
PKMYT1 Rabbit Polyclonal Antibody
TA351532

USD 380.00

In Stock

Rabbit Polyclonal Anti-PKMYT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PKMYT1
PKMYT1 Rabbit Polyclonal Antibody
TA312141

USD 380.00

In Stock

Rabbit polyclonal MYT1 (Ab-83) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MYT1 around the phosphorylation site of serine 83 (R-V-SP-F-R).
PKMYT1 Rabbit Polyclonal Antibody
TA341798

USD 539.00

5 Days

Rabbit Polyclonal Anti-Myt1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Myt1 antibody: synthetic peptide directed towards the n terminal of mouse Myt1. Synthetic peptide located within the following region: VSKRKSHPLRLALDEGYRMDSDGSEDAEVKDVSVSDESEGPLEEAEAEMS
PKMYT1 Rabbit Polyclonal Antibody
TA312142

USD 380.00

4 Weeks

Rabbit polyclonal MYT1 (Ser83) antibody(Phospho-specific)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human MYT1 around the phosphorylation site of serine 83 (R-V-SP-F-R).
Modifications Phospho-specific