Germany
Japan
United Kingdom
China
Products
View as table Download
HNF4A mouse monoclonal antibody, clone OTI8B8 (formerly 8B8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HNF4A mouse monoclonal antibody, clone OTI9H8 (formerly 9H8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HNF4A mouse monoclonal antibody, clone OTI5A9 (formerly 5A9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HNF4A mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HNF4A mouse monoclonal antibody, clone OTI8B8 (formerly 8B8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HNF4A mouse monoclonal antibody, clone OTI9H8 (formerly 9H8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HNF4A mouse monoclonal antibody, clone OTI5A9 (formerly 5A9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HNF4A mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal HNF4A Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Rat (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | This HNF4A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 281-312 amino acids from the Central region of human HNF4A. |
HNF 4 alpha (HNF4A) (2-15) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Human, Porcine, Bat, Equine, Hamster, Monkey, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from the N-terminus of human HNF4A / HNF4 (NP_849180.1; NP_000448.3; NP_849181.1) |
Goat Polyclonal Antibody against HNF4A
| Applications | IHC, PEP-ELISA, WB |
| Reactivities | Human (Expected from sequence similarity: Dog, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence RLSKTLVDMDMADY-C, from the N Terminus of the protein sequence according to NP_849180.1; NP_000448.3; NP_849181.1. |
HNF4A mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-HNF4A Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HNF4A antibody is: synthetic peptide directed towards the N-terminal region of Human HNF4A. Synthetic peptide located within the following region: MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNA |
Active filters
Target Symbol
- HNF 4 ALPHA
Conjugates
- Unconjugated
Families
- Druggable Genome