SEC11A mouse monoclonal antibody,clone OTI1A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SEC11A mouse monoclonal antibody,clone OTI1A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SEC11A mouse monoclonal antibody,clone OTI1A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SEC11A mouse monoclonal antibody,clone OTI1A11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SEC11A mouse monoclonal antibody,clone OTI1A11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SEC11A mouse monoclonal antibody,clone OTI1A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-SRPR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SRPR antibody: synthetic peptide directed towards the N terminal of human SRPR. Synthetic peptide located within the following region: DSEKAKKPVRSMIETRGEKPKEKAKNSKKKGAKKEGSDGPLATSKPVPAE |
Rabbit Polyclonal Anti-SRPR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SRPR antibody: synthetic peptide directed towards the middle region of human SRPR. Synthetic peptide located within the following region: EEFIQKHGRGMEKSNKSTKSDAPKEKGKKAPRVWELGGCANKEVLDYSTP |
SEC11A mouse monoclonal antibody,clone OTI1A11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".