Products

View as table Download

UQCRFS1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 188-217 amino acids from the C-terminal region of human UQCRFS1

Rabbit Polyclonal antibody to UQCRFS1 (ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1)

Applications IF, WB
Reactivities Human, Mouse (Predicted: Rat, Cow)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 274 of UQCRFS1 (Uniprot ID#P47985)

Rabbit Polyclonal Anti-UQCRFS1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UQCRFS1 antibody: synthetic peptide directed towards the N terminal of human UQCRFS1. Synthetic peptide located within the following region: MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL