Products

Jump to Filters
View as table Download
SEMA6A Rabbit Polyclonal Antibody
TA351643

USD 380.00

In Stock

Rabbit Polyclonal Anti-SEMA6A Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SEMA6A
SEMA6A Rabbit Polyclonal Antibody
TA351644

USD 380.00

In Stock

Rabbit Polyclonal Anti-SEMA6A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SEMA6A
SEMA6A Rabbit Polyclonal Antibody
TA338441

USD 539.00

5 Days

Rabbit Polyclonal Anti-SEMA6A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEMA6A antibody: synthetic peptide directed towards the middle region of human SEMA6A. Synthetic peptide located within the following region: ERVPKPRPGCCAGSSSLERYATSNEFPDDTLNFIKTHPLMDEAVPSIFNR