Germany
Japan
United Kingdom
China
Products
USD 509.00
2 Weeks
ACVRL1 (N-term) rabbit polyclonal antibody, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of Human ACVRL1. |
ACVRL1 mouse monoclonal antibody,clone OTI5C2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ACVRL1 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KISNSPEKPKVIQ, from the C Terminus of the protein sequence according to NP_000011.2; NP_001070869.1. |
Rabbit Polyclonal Anti-ACVRL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACVRL1 antibody: synthetic peptide directed towards the N terminal of human ACVRL1. Synthetic peptide located within the following region: SPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNH |
ACVRL1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ACVRL1 |
| Modifications | Unmodified |
Active filters
Category
-
- Antibodies
-
-
-
-
Target Symbol
- ACVRL1