Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit Polyclonal Anti-TPM1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPM1 antibody: synthetic peptide directed towards the N terminal of human TPM1. Synthetic peptide located within the following region: DRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQE |
Rabbit Polyclonal Anti-TPM1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPM1 antibody: synthetic peptide directed towards the middle region of human TPM1. Synthetic peptide located within the following region: LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED |
Tropomyosin-1 alpha phospho S283 Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Tropomyosin-1 alpha pS283 affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide surrounding S283 human Tropomyosin-1 alpha pS283. |