Products

Proteins (2)
Antibodies (1)
Jump to Filters
View as table Download
DNA Primase (PRIM2) (NM_000947) Human Over-expression Lysate
LC424442

USD 134.00

2 Weeks

PRIM2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DNA Primase (PRIM2) (NM_000947) Human Over-expression Lysate
LY424442

USD 436.00

5 Days

Transient overexpression lysate of primase, DNA, polypeptide 2 (58kDa) (PRIM2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DNA Primase (PRIM2) Rabbit Polyclonal Antibody
TA331030

USD 485.00

5 Days

Rabbit polyclonal Anti-PRIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRIM2 antibody: synthetic peptide directed towards the middle region of human PRIM2. Synthetic peptide located within the following region: QDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFKSIYKPPFAS