Rabbit polyclonal HMGA1 Antibody (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Hamster) |
| Conjugation | Unconjugated |
| Immunogen | This HMGA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 64-93 amino acids from the C-terminal region of human HMGA1. |
Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 5
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Anti-HMGA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 12-24 amino acids of Human high mobility group AT-hook 1 |
HMGA1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
HMGA1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Goat Anti-HMGA1 (aa9-21) Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SQPLASKQEKDGT, from the internal region (near N Terminus) of the protein sequence according to NP_665906.1; NP_002122.1. |
Rabbit Polyclonal Anti-HMGA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HMGA1 Antibody: synthetic peptide directed towards the N terminal of human HMGA1. Synthetic peptide located within the following region: MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRP |
Rabbit Polyclonal Anti-Hmga1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Hmga1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hmga1. Synthetic peptide located within the following region: MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPSVSPGTALVGSQKEPSE |
HMGA1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
HMGA1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
HMGA1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
HMGA1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
HMGA1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Germany
Japan
United Kingdom
China
