Rabbit Polyclonal Anti-DOLPP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DOLPP1 antibody: synthetic peptide directed towards the N terminal of human DOLPP1. Synthetic peptide located within the following region: AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI |
DOLPP1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human DOLPP1 |
DOLPP1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
DOLPP1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of dolichyl pyrophosphate phosphatase 1 (DOLPP1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of dolichyl pyrophosphate phosphatase 1 (DOLPP1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Germany
Japan
United Kingdom
China
