Products

View as table Download

Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)

Applications FC, IF, WB
Reactivities Human, Dog, Mouse, Rat
Conjugation Unconjugated

ADH1B mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications FC, IF, IHC, WB
Reactivities Human, Dog, Rat
Conjugation Unconjugated

ALDH1A3 mouse monoclonal antibody, clone OTI4E8 (formerly 4E8)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PFKP mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HK2 mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)

Applications FC, IF, WB
Reactivities Human, Dog, Mouse, Rat
Conjugation Unconjugated

Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PFKP mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LDHA mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal FALDH Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

ADH1B mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications FC, IF, IHC, WB
Reactivities Human, Dog, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ALDH1A3 mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)

Applications FC, IHC, WB
Reactivities Human, Dog, Monkey, Mouse, Rat
Conjugation Unconjugated

PFKP mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)

Applications FC, IF, IHC, WB
Reactivities Human, Dog, Monkey, Mouse, Rat
Conjugation Unconjugated

LDHA mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM