Germany
Japan
United Kingdom
China
DCC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Products
View as table Download
DCC mouse monoclonal antibody, clone OTI5D10 (formerly 5D10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DCC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) DCC mouse monoclonal antibody, clone OTI5D10 (formerly 5D10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
DCC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
DCC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
DCC mouse monoclonal antibody, clone OTI5D10 (formerly 5D10), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
DCC mouse monoclonal antibody, clone OTI5D10 (formerly 5D10), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
DCC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-DCC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCC antibody: synthetic peptide directed towards the middle region of human DCC. Synthetic peptide located within the following region: PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQ |
DCC mouse monoclonal antibody, clone OTI5D10 (formerly 5D10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Category
- Antibodies
Target Symbol
- DCC
Applications
- WB
Pathways
- Axon guidance