DCC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DCC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DCC mouse monoclonal antibody, clone OTI5D10 (formerly 5D10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DCC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) DCC mouse monoclonal antibody, clone OTI5D10 (formerly 5D10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DCC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
DCC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
DCC mouse monoclonal antibody, clone OTI5D10 (formerly 5D10), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
DCC mouse monoclonal antibody, clone OTI5D10 (formerly 5D10), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
DCC (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 642-670 amino acids from the Central region of Human DCC. |
DCC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-DCC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DCC antibody: synthetic peptide directed towards the middle region of human DCC. Synthetic peptide located within the following region: PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQ |
DCC mouse monoclonal antibody, clone OTI5D10 (formerly 5D10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".