Products

Jump to Filters
View as table Download
TAF6 Rabbit Polyclonal Antibody
TA337292

USD 485.00

5 Days

Rabbit Polyclonal Anti-TAF6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF6 antibody: synthetic peptide directed towards the N terminal of human TAF6. Synthetic peptide located within the following region: LTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHA