Products

Jump to Filters
View as table Download
EMA (MUC1) Rabbit Polyclonal Antibody
TA336810

USD 550.00

5 Days

Rabbit Polyclonal MUC-1 Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.
Neurokinin 1 Receptor (TACR1) Rabbit Polyclonal Antibody
TA309893

USD 550.00

2 Weeks

Rabbit Polyclonal Neurokinin 1 Receptor Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Guinea Pig, Human, Rat
Conjugation Unconjugated
Immunogen A peptide derived from the N-terminus of human NK-1 sequence conjugated to KLH.
Rbpms Rabbit Polyclonal Antibody
TA389027

USD 545.00

5 Days

Anti-RBPMS Antibody

Applications FC, ICC, IHC, WB
Reactivities Feline, Guinea Pig, Pig, Human, Mouse, Rabbit, Rat, Tree Shrew, Whale, Zebrafish
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the N-terminal region of rat RBPMS, conjugated to keyhole limpet hemocyanin (KLH).