Products

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 15 of 18 results

Page 1 of 2

(reset)

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: 9E10]

TA336685

USD 550.00

In Stock

Mouse Monoclonal c-Myc Antibody (9E10)

Applications	ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Sandwich ELISA, Simple Western, WB
Reactivities	Human, Mouse, Drosophila
Conjugation	Unconjugated

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: Pab 240]

TA336582

USD 550.00

5 Days

Mouse Monoclonal p53 Antibody (PAb 240)

Applications	CyTOF-ready, ELISA, FC, ICC/IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat, Yeast (Does not react with: Xenopus)
Conjugation	Unconjugated

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

PCNA Rabbit Polyclonal Antibody

TA590137

USD 482.00

In Stock

Rabbit Polyclonal PCNA Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the Middle Region of the target protein.

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

PCNA Mouse Monoclonal Antibody [Clone ID: PC10]

TA309795

USD 605.00

5 Days

Mouse Monoclonal PCNA Antibody (PC10)

Applications	ChIP, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities	Chicken, Drosophila, Human, Mouse, Rat, Yeast
Conjugation	Unconjugated

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

HDAC2 Rabbit Polyclonal Antibody

TA590734

USD 482.00

In Stock

Rabbit Polyclonal HDAC2 Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: 9E11]

TA336584

USD 640.00

5 Days

Mouse Monoclonal c-Myc Antibody (9E11)

Applications	CyTOF-ready, ELISA, FC, ICC/IF, IHC, IP, WB
Reactivities	Human, Mouse, Chicken, Yeast
Conjugation	Unconjugated

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

c-Myc (MYC) Rabbit Polyclonal Antibody

TA336686

USD 550.00

5 Days

Rabbit Polyclonal c-Myc Antibody

Applications	ChIP, ELISA, ICC/IF, IHC, IP, Simple Western, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106]

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

MCM6 Rabbit Polyclonal Antibody

TA590213

USD 482.00

In Stock

Rabbit Polyclonal MCM6 Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Dog, Monkey, Mouse
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

BubR1 (BUB1B) Rabbit Polyclonal Antibody

TA590739

USD 482.00

In Stock

Rabbit Polyclonal BubR1 Antibody

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA329146

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications	ELISA, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Cyclin A2 (CCNA2) Rabbit Polyclonal Antibody

TA590075

USD 482.00

In Stock

Rabbit Polyclonal Cyclin A2 Antibody

Applications	ELISA, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

1 / 3

2 / 3

3 / 3

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA329142

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications	ELISA, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP

1 / 3

2 / 3

3 / 3

Previous Next

Cyclin B2 (CCNB2) Rabbit Polyclonal Antibody

TA590623

USD 482.00

In Stock

Rabbit Polyclonal Cyclin B2 Antibody

Applications	ELISA, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

1 / 2

2 / 2

Previous Next

c-Myc (MYC) Rabbit Polyclonal Antibody

R1182

USD 525.00

2 Weeks

c-Myc (MYC) rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, IHC, WB
Conjugation	Unconjugated
Immunogen	This antibody was purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide.

c-Myc (MYC) Chicken Polyclonal Antibody

AP31790PU-N

USD 520.00

2 Weeks

c-Myc (MYC) chicken polyclonal antibody, Aff - Purified

Applications	ELISA, IF, IHC, IP, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%.

1 - 15 of 18 results

Page 1 of 2