Products

View as table Download

Rabbit anti-CDA Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CDA

Rabbit Polyclonal Anti-CDA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDA antibody: synthetic peptide directed towards the C terminal of human CDA. Synthetic peptide located within the following region: SPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDLQKTQ