Rabbit polyclonal Anti-RASGRF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RASGRF1 antibody: synthetic peptide directed towards the N terminal of human RASGRF1. Synthetic peptide located within the following region: RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG |
Rabbit polyclonal Anti-RASGRF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RASGRF1 antibody: synthetic peptide directed towards the middle region of human RASGRF1. Synthetic peptide located within the following region: PMSEKGKITRGRLGSLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNG |
Rabbit polyclonal anti-Ras-GRF1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human Ras-GRF1. |
Germany
Japan
United Kingdom
China
