Products

View as table Download

Rabbit Polyclonal Anti-KV11.1 (HERG) (extracellular)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG). Extracellular, between S1 and S2 domains.

Rabbit Polyclonal Anti-hKV11.1 (HERG)

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GST fusion protein with sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human Kv11.1 (HERG). Intracellular, C-terminus.