Research Areas

Jump to Filters
View as table Download
Aryl hydrocarbon Receptor (AHR) (N-term) Rabbit Polyclonal Antibody
AP23638PU-N

USD 535.00

2 Weeks

Aryl hydrocarbon Receptor (AHR) (N-term) rabbit polyclonal antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic AhR peptide - KLH conjugated
Aryl hydrocarbon Receptor (AHR) Rabbit Polyclonal Antibody
TA313163

USD 380.00

In Stock

Rabbit polyclonal AhR (Ser36) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human AhR around the phosphorylation site of serine 36 (N-P-SP-K-R).
Modifications Phospho-specific
Aryl hydrocarbon Receptor (AHR) Rabbit Polyclonal Antibody
TA330210

USD 485.00

5 Days

Rabbit Polyclonal Anti-AHR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AHR antibody: synthetic peptide directed towards the N terminal of human AHR. Synthetic peptide located within the following region: RAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQALNGFVL
Aryl hydrocarbon Receptor (AHR) Rabbit Polyclonal Antibody
TA313162

USD 380.00

In Stock

Rabbit polyclonal AhR (Ab-36) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human AhR around the phosphorylation site of serine 36 (N-P-SP-K-R).
Aryl hydrocarbon Receptor (AHR) Rabbit Polyclonal Antibody
TA329363

USD 485.00

5 Days

Rabbit Polyclonal anti-AHR antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AHR antibody: synthetic peptide directed towards the N terminal of human AHR. Synthetic peptide located within the following region: MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRL
Aryl hydrocarbon Receptor (AHR) Rabbit Polyclonal Antibody
TA350968

USD 380.00

In Stock

Rabbit Polyclonal Anti-AHR Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human AHR
Aryl hydrocarbon Receptor (AHR) Rabbit Polyclonal Antibody
TA325212

USD 380.00

In Stock

Rabbit Polyclonal AhR (Ser36) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human AhR around the phosphorylation site of Serine 36
Modifications Phospho-specific
Aryl hydrocarbon Receptor (AHR) Rabbit Polyclonal Antibody
TA325211

USD 380.00

2 Weeks

Rabbit Polyclonal AhR Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human AhR
Aryl hydrocarbon Receptor (AHR) Goat Polyclonal Antibody
TA326720

USD 520.00

5 Days

Goat Anti-Aryl Hydrocarbon Receptor (aa749-763) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KHGLNPQSAIITPQT, from the internal region of the protein sequence according to NP_001612.1.