Research Areas

cDNA Clones (11)
Proteins (7)
Antibodies (4)
Jump to Filters
View as table Download
CX3CL1 Rabbit Polyclonal Antibody
TA336789

USD 550.00

5 Days

Rabbit Polyclonal CX3CL1/Fractalkine Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human CX3CL protein (within residues 20-150). [Swiss-Prot P78423]
CX3CL1 Rabbit Polyclonal Antibody
TA322919

USD 380.00

2 Weeks

Anti-CX3CL1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 368-381 amino acids of Human chemokine (C-X3-C motif) ligand 1
CX3CL1 Goat Polyclonal Antibody
TA329093

USD 520.00

5 Days

CX3CL1 / fractalkine (aa214-226) Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Internal region (KTSEAPSTQDPST)
CX3CL1 Rabbit Polyclonal Antibody
TA329183

USD 485.00

5 Days

Rabbit Polyclonal Anti-CX3CL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CX3CL1 antibody is: synthetic peptide directed towards the middle region of Human CX3CL1. Synthetic peptide located within the following region: APHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQRVWGQ