Research Areas

View as table Download

Rabbit polyclonal Anti-RPL5 Antibody

Applications WB
Reactivities Human, Arabidopsis thaliana
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL5 antibody: synthetic peptide directed towards the N terminal of human RPL5. Synthetic peptide located within the following region: RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP

Rabbit Polyclonal Anti-RPS3A Antibody

Applications WB
Reactivities Human, Arabidopsis thaliana
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS3A Antibody: synthetic peptide directed towards the N terminal of human RPS3A. Synthetic peptide located within the following region: APAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKF