Research Areas

Jump to Filters
View as table Download
BCKDHA Rabbit Polyclonal Antibody
TA335154

USD 539.00

5 Days

Rabbit polyclonal Anti-BCKDHA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCKDHA antibody: synthetic peptide directed towards the N terminal of human BCKDHA. Synthetic peptide located within the following region: NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY
BCKDHA (C-term) Rabbit Polyclonal Antibody
AP17149PU-N

USD 580.00

2 Weeks

BCKDHA (C-term) rabbit polyclonal antibody

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected between aa 362-390 of the C-terminal region of human BCKDHA