Research Areas

View as table Download

Rabbit Polyclonal Anti-RAD54B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD54B antibody: synthetic peptide directed towards the N terminal of human RAD54B. Synthetic peptide located within the following region: DAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEV

Rabbit Polyclonal Anti-RAD54B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD54B antibody: synthetic peptide directed towards the middle region of human RAD54B. Synthetic peptide located within the following region: NSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIFQNITTQATGT

Rabbit polyclonal anti-RAD54B antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RAD54B.