Liver Diseases

cDNA Clones (22)
Proteins (16)
Primary Antibodies (8)
Jump to Filters
View as table Download
Alanine Transaminase (GPT) Rabbit Polyclonal Antibody
TA322631

USD 380.00

In Stock

Anti-GPT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-14 amino acids of Human Alanine aminotransferase 1
Alanine Transaminase (GPT) Rabbit Polyclonal Antibody
TA338150

USD 485.00

In Stock

Rabbit Polyclonal Anti-GPT Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPT antibody: synthetic peptide directed towards the N terminal of human GPT. Synthetic peptide located within the following region: RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT
Alanine Transaminase (GPT) Rabbit Polyclonal Antibody
TA322630

USD 380.00

In Stock

Anti-GPT Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-14 amino acids of Human glutamic-pyruvate transaminase (alanine aminotransferase)
Alanine Transaminase (GPT) Rabbit Polyclonal Antibody
TA322632

USD 380.00

In Stock

Anti-GPT Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 101-114 amino acids of human glutamic-pyruvate transaminase (alanine aminotransferase)
Alanine Transaminase (GPT) Rabbit Polyclonal Antibody
TA338151

USD 485.00

5 Days

Rabbit Polyclonal Anti-GPT Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPT antibody: synthetic peptide directed towards the N terminal of human GPT. Synthetic peptide located within the following region: FLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQ
Alanine Transaminase (GPT) Rabbit Polyclonal Antibody
TA338152

USD 485.00

5 Days

Rabbit Polyclonal Anti-GPT Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPT antibody: synthetic peptide directed towards the N terminal of human GPT. Synthetic peptide located within the following region: CGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAI
GPT2 Rabbit Polyclonal Antibody
TA329574

USD 539.00

5 Days

Rabbit polyclonal anti-GPT2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPT2 antibody: synthetic peptide directed towards the C terminal of human GPT2. Synthetic peptide located within the following region: PEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVR
Alanine Transaminase (GPT) Rabbit Polyclonal Antibody
TA324938

USD 580.00

5 Days

Rabbit polyclonal GPT Antibody (N-term R133)

Applications WB
Reactivities Human, Mouse, Rat (Predicted: Bovine)
Conjugation Unconjugated
Immunogen This GPT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 118-144 amino acids from the N-terminal region of human GPT.