Liver Diseases

Jump to Filters
View as table Download
IL6R Rabbit Polyclonal Antibody
AP31764PU-N

USD 535.00

In Stock

IL6R rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide
CD95 (FAS) Rabbit Polyclonal Antibody
TA323754

USD 380.00

4 Weeks

Anti-FAS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 156-335 amino acids of human Fas (TNF receptor superfamily, member 6)
CD95 (FAS) Rabbit Polyclonal Antibody
TA313381

USD 380.00

In Stock

Rabbit polyclonal anti-FAS antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Fas.
CD95 (FAS) Rabbit Polyclonal Antibody
TA590390

USD 482.00

In Stock

Rabbit Polyclonal Fas Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
CD95 (FAS) Rabbit Polyclonal Antibody
AP06448PU-N

USD 465.00

3 Weeks

CD95 (FAS) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 280-330 of Human CD95.
IL6R Rabbit Polyclonal Antibody
TA327080

USD 365.00

3 Weeks

Rabbit anti-IL-6R Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IL-6R
CD95 (FAS) (Center) Rabbit Polyclonal Antibody
AP18016PU-N

USD 580.00

2 Weeks

CD95 (FAS) (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen conjugated synthetic peptide selected from the Center region of human FAS
CD95 (FAS) (323-327) Rabbit Polyclonal Antibody
AP26059PU-N

USD 405.00

2 Weeks

CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around aa.323~327 derived from human Fas .
CD95 (FAS) (323-327) Rabbit Polyclonal Antibody
AP26059PU-S

USD 315.00

2 Weeks

CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around aa.323~327 derived from human Fas .
CD95 (FAS) Goat Polyclonal Antibody
TA305714

USD 520.00

5 Days

Goat Anti-FAS / CD95 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KTCRKHRKENQGSH, from the internal region of the protein sequence according to NP_000034.1; NP_690610.1; NP_690611.1.
CD95 (FAS) Rabbit Polyclonal Antibody
TA326787

USD 365.00

3 Weeks

FAS Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human FAS
CD95 (FAS) Rabbit Polyclonal Antibody
TA337864

USD 539.00

5 Days

Rabbit Polyclonal Anti-FAIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD
IL6R Rabbit Polyclonal Antibody
TA363756

USD 539.00

5 Days

IL6R Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human IL6R
CD95 (FAS) Rabbit Polyclonal Antibody
TA354221

USD 425.00

5 Days

Rabbit anti CD95 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated