Immunology

Jump to Filters
View as table Download
CPT1A Goat Polyclonal Antibody
TA303144

USD 520.00

2 Weeks

Goat Polyclonal Antibody against CPT1A

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DPAQTVEQRLKLFK, from the internal region of the protein sequence according to NP_001867.2; NP_001027017.1.
CPT1A Rabbit Polyclonal Antibody
TA323383

USD 380.00

In Stock

Anti-CPT1A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human carnitine palmitoyltransferase 1A (liver)
CPT1A Rabbit Polyclonal Antibody
TA332600

USD 365.00

2 Weeks

Rabbit anti-CPT1A Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CPT1A
CPT1A Rabbit Polyclonal Antibody
TA336036

USD 539.00

5 Days

Rabbit Polyclonal Anti-CPT1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CPT1A Antibody: synthetic peptide directed towards the middle region of human CPT1A. Synthetic peptide located within the following region: LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN
CPT1A Rabbit Polyclonal Antibody
TA323382

USD 380.00

4 Weeks

Anti-CPT1A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human carnitine palmitoyltransferase 1A (liver)