Immunology

Jump to Filters
View as table Download
ACOX1 Rabbit Polyclonal Antibody
TA324048

USD 380.00

In Stock

Anti-ACOX1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA oxidase 1, palmitoyl
Calcium independent Phospholipase A2 (PLA2G6) Rabbit Polyclonal Antibody
TA314745

USD 380.00

In Stock

Rabbit polyclonal anti-PA2G6 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PA2G6.
Phospholipase A2 (PLA2G4A) Rabbit Polyclonal Antibody
TA326028

USD 380.00

In Stock

Rabbit Polyclonal c-PLA2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-PLA2
Phospholipase A2 (PLA2G4A) Rabbit Polyclonal Antibody
TA326029

USD 380.00

In Stock

Rabbit Polyclonal c-PLA2 (Ser505) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-PLA2 around the phosphorylation site of Serine 505
Modifications Phospho-specific
PLA2G12A Rabbit Polyclonal Antibody
TA308641

USD 625.00

5 Days

Rabbit polyclonal antibody to Phospholipase A2 XIIA (phospholipase A2, group XIIA)

Applications WB
Reactivities Human (Predicted: Rat, Bovine, Rhesus Monkey, Mouse)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 22 and 115 of PLA2G12A (Uniprot ID#Q9BZM1)
PLA2G3 Rabbit Polyclonal Antibody
TA317693

USD 515.00

5 Days

PLA2G3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Gorilla, Human, Monkey, Pig, Gibbon (Predicted: Mouse, Horse, Rabbit)
Conjugation Unconjugated
Immunogen PLA2G3 antibody was raised against synthetic 12 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Elephant, Panda, Pig (100%); Mouse, Horse, Rabbit (92%); Bat, Dog, Opossum (83%).
ACOX3 Rabbit Polyclonal Antibody
TA343059

USD 539.00

5 Days

Rabbit Polyclonal Anti-ACOX3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ACOX3 antibody: synthetic peptide directed towards the C terminal of human ACOX3. Synthetic peptide located within the following region: SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT