Immunology

Jump to Filters
View as table Download
DPPA2 Rabbit Polyclonal Antibody
TA321930

USD 380.00

In Stock

Anti-DPPA2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 92-298 amino acids of human developmental pluripotency associated 2
DPPA2 Rabbit Polyclonal Antibody
TA321929

USD 380.00

4 Weeks

Anti-DPPA2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 92-298 amino acids of human developmental pluripotency associated 2
DPPA2 Rabbit Polyclonal Antibody
TA340320

USD 539.00

5 Days

Rabbit Polyclonal Anti-DPPA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DPPA2 antibody: synthetic peptide directed towards the N terminal of human DPPA2. Synthetic peptide located within the following region: NMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPL