Immunology

Jump to Filters
View as table Download
XYLT1 Rabbit Polyclonal Antibody
TA338489

USD 539.00

5 Days

Rabbit Polyclonal Anti-XYLT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XYLT1 antibody: synthetic peptide directed towards the middle region of human XYLT1. Synthetic peptide located within the following region: RITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKF
XYLT1 (N-term) Rabbit Polyclonal Antibody
AP54591PU-N

USD 580.00

2 Weeks

XYLT1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 133-163 amino acids from the N-terminal region of human XYLT1