Immunology

Jump to Filters
View as table Download
Claudin 10 (CLDN10) Rabbit Polyclonal Antibody
TA321794

USD 380.00

In Stock

Anti-CLDN10 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 215-228 amino acids of Human claudin 10
Claudin 10 (CLDN10) Rabbit Polyclonal Antibody
TA311647

USD 380.00

In Stock

Rabbit polyclonal Claudin 10 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Claudin 10.
Claudin 10 (CLDN10) Rabbit Polyclonal Antibody
TA321795

USD 380.00

In Stock

Anti-CLDN10 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 215-228 amino acids of Human claudin 11
Claudin 10 (CLDN10) Rabbit Polyclonal Antibody
TA354159

USD 425.00

5 Days

Rabbit anti Claudin 10 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide from C-terminus of human claudin 10 protein.
Claudin 10 (CLDN10) Rabbit Polyclonal Antibody
TA333900

USD 485.00

5 Days

Rabbit Polyclonal Anti-CLDN10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CLDN10 Antibody: synthetic peptide directed towards the C terminal of human CLDN10. Synthetic peptide located within the following region: MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLW
Claudin 10 (CLDN10) Rabbit Polyclonal Antibody
TA347357

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Claudin 10 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 10 Antibody: A synthesized peptide derived from human Claudin 10