Immunology

View as table Download

Rabbit polyclonal anti-GLCTK antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GLCTK.

Rabbit Polyclonal antibody to GLYCTK (glycerate kinase)

Applications WB
Reactivities Human, Mouse (Predicted: Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 144 and 523 of GLYCTK (Uniprot ID#Q8IVS8)

Rabbit Polyclonal Anti-GLYCTK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLYCTK antibody: synthetic peptide directed towards the N terminal of human GLYCTK. Synthetic peptide located within the following region: IQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGA

Rabbit Polyclonal Anti-GLYCTK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLYCTK antibody: synthetic peptide directed towards the middle region of human GLYCTK. Synthetic peptide located within the following region: KPHSRVQVFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGS