Immunology

cDNA Clones (48)

Proteins (6)

Antibodies (2) ×

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 2 of 2 results

(reset)

NEDD4 2 (NEDD4L) Rabbit Polyclonal Antibody

TA350226

USD 380.00

In Stock

Rabbit Polyclonal Anti-NEDD4L Antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human NEDD4L

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

NEDD4 2 (NEDD4L) Rabbit Polyclonal Antibody

TA329852

USD 539.00

5 Days

Rabbit Polyclonal Anti-NEDD4L Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-NEDD4L antibody: synthetic peptide directed towards the middle region of human NEDD4L. Synthetic peptide located within the following region: TVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLP

1 / 2

2 / 2

Previous Next

1 - 2 of 2 results