Germany
Japan
United Kingdom
China
Immunology
View as table Download
Rabbit polyclonal anti-UBE2I Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UBE2I |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Recombinant Anti-UBE2I (Clone SAIC-36A-9)
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
UBE2I mouse monoclonal antibody, clone 67AT1273.95.90, Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Goat Polyclonal Antibody against UBE2I
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence SGIALSRLAQERK-C, from the N Terminus of the protein sequence according to NP_003336.1; NP_919235.1; NP_919236.1; NP_919237.1. |
Rabbit Polyclonal Anti-SLC38A4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC38A4 antibody: synthetic peptide directed towards the middle region of human SLC38A4. Synthetic peptide located within the following region: LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV |
