Immunology

Jump to Filters
View as table Download
ATIC Rabbit Polyclonal Antibody
TA339263

USD 485.00

5 Days

Rabbit Polyclonal Anti-ATIC Antibody

Applications WB
Reactivities Human, Hamster
Conjugation Unconjugated
Immunogen The immunogen for anti-ATIC antibody: synthetic peptide directed towards the N terminal of human ATIC. Synthetic peptide located within the following region: YVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKG