Immunology

View as table Download

Rabbit Polyclonal Anti-MAPKAPK2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAPKAPK2

Rabbit polyclonal MAPKAPK2 (Ab-272) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MAPKAPK2 around the phosphorylation site of serine 272 (A-I-SP-P-G).

Rabbit polyclonal MAPKAPK2 (Ser272) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human MAPKAPK2 around the phosphorylation site of serine 272 (A-I-SP-P-G).
Modifications Phospho-specific

Rabbit polyclonal MAPKAP Kinase 2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Immunogen: This antibody was affinity purified from whole rabbit serum prepared by repeated immunizations with a synthetic peptide corresponding to aa 310-325 of rabbit MAPKAP Kinase 2 conjugated to KLH using maleimide. A terminal cysteine residue was added to facilitate coupling.

Rabbit Polyclonal Anti-MAPKAPK2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MAPKAPK2 antibody is: synthetic peptide directed towards the C-terminal region of Human MAPKAPK2. Synthetic peptide located within the following region: MNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKGCLHDKNSDQATWLTR

Rabbit Polyclonal Anti-MAPKAPK2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MAPKAPK2 antibody: synthetic peptide directed towards the middle region of human MAPKAPK2. Synthetic peptide located within the following region: KLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMY

Rabbit polyclonal MAPKAPK2 (Thr334) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human MAPKAPK2 around the phosphorylation site of threonine 334 (P-Q-TP-P-L).
Modifications Phospho-specific