Germany
Japan
United Kingdom
China
Immunology
View as table Download
USD 509.00
2 Weeks
Rabbit Polyclonal FoxP3 Antibody
| Applications | FC, ICC/IF, IHC, Immunoblotting, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A peptide corresponding to amino acids 43-100 of mouse FOXP3. [Swiss-Prot# Q99JB6] |
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
FOXP3 mouse monoclonal antibody,clone UMAB248
| Applications | 10k-ChIP, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
FOXP3 mouse monoclonal antibody,clone OTI3D1
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Goat Polyclonal Antibody against FOXP3 / SCURFIN
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Dog, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence SQRPSRCSNPTPGP, from the C Terminus of the protein sequence according to NP_054728.2. |
Rabbit Polyclonal Anti-FOXP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXP3 antibody: synthetic peptide directed towards the N terminal of human FOXP3. Synthetic peptide located within the following region: PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGL |
FOXP3 mouse monoclonal antibody, clone SPM579, Purified
| Applications | FC, IF, IHC |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- FOXP3
Applications
- IHC