Immunology

Jump to Filters
View as table Download
PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody
TA333060

USD 450.00

3 Weeks

Phospho-PRKCB-T641 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T641 of human PRKCB
Modifications Phospho-specific
PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody
TA302123

USD 580.00

5 Days

Rabbit Polyclonal Antibody against PRKCB1 (C-term)

Applications IHC, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen This PKC beta2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-673 amino acids from the C-terminal region of human PKC beta2.
PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody
TA327788

USD 380.00

In Stock

Rabbit Polyclonal Phospho-PKCB (Ser661) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PKCB around the phosphorylation site of Serine 661
Modifications Phospho-specific
PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody
TA327842

USD 380.00

In Stock

Rabbit Polyclonal PKCB Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PKCB
PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody
TA350904

USD 380.00

In Stock

Rabbit Polyclonal Anti-PRKCB Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRKCB
PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody
TA332954

USD 365.00

3 Weeks

Rabbit anti-PRKCB Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRKCB
PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody
TA342146

USD 539.00

5 Days

Rabbit polyclonal Anti-PRKCB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKCB1 antibody: synthetic peptide directed towards the N terminal of human PRKCB1. Synthetic peptide located within the following region: MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC
PKC beta 1 (PRKCB) Rabbit Polyclonal Antibody
TA342147

USD 539.00

5 Days

Rabbit polyclonal Anti-PRKCB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKCB1 antibody: synthetic peptide directed towards the N terminal of human PRKCB1. Synthetic peptide located within the following region: CFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS