Immunology

Jump to Filters
View as table Download
NR5A2 Rabbit Polyclonal Antibody
TA332898

USD 365.00

3 Weeks

Rabbit anti-NR5A2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NR5A2
NR5A2 Rabbit Polyclonal Antibody
TA330583

USD 539.00

5 Days

Rabbit Polyclonal Anti-NR5A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR5A2 antibody: synthetic peptide directed towards the middle region of human NR5A2. Synthetic peptide located within the following region: LPPTDYDRSPFVTSPISMTMLHGSLQGYQTYGHFPSRAIKSEYPDPYTSS
NR5A2 Rabbit Polyclonal Antibody
TA343425

USD 485.00

5 Days

Rabbit Polyclonal Anti-NR5A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR5A2 antibody: synthetic peptide directed towards the N terminal of human NR5A2. Synthetic peptide located within the following region: MSSNSDTGDLQESLKHGLTPIVSQFKMVNYSYDEDLEELCPVCGDKVSGY