Cytokines

Primary Antibodies (40)
View as table Download

TNFRSF18 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

TNFRSF18 mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

TNFRSF18 mouse monoclonal antibody, clone OTI4A9 (formerly 4A9)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

TNFRSF18 mouse monoclonal antibody, clone OTI9G8 (formerly 9G8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-TNFRSF18 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF18 antibody: synthetic peptide directed towards the C terminal of human TNFRSF18. Synthetic peptide located within the following region: LRSQCMWPRETQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLWV

Rabbit Polyclonal Anti-TNFRSF18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF18 antibody: synthetic peptide directed towards the C terminal of human TNFRSF18. Synthetic peptide located within the following region: LHIWQLRKTQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLWV