Autoimmunity

View as table Download

Rabbit Polyclonal Anti-TMED1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human TMED1

Rabbit Polyclonal Anti-TMED1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMED1 antibody: synthetic peptide directed towards the middle region of human TMED1. Synthetic peptide located within the following region: FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF