TMED1 mouse monoclonal antibody, clone OTI7D2 (formerly 7D2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TMED1 mouse monoclonal antibody, clone OTI7D2 (formerly 7D2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TMED1 mouse monoclonal antibody, clone OTI7D2 (formerly 7D2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TMED1 mouse monoclonal antibody, clone OTI7G4 (formerly 7G4)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TMED1 mouse monoclonal antibody, clone OTI7G4 (formerly 7G4)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TMED1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TMED1 |
Rabbit Polyclonal Anti-TMED1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TMED1 antibody: synthetic peptide directed towards the middle region of human TMED1. Synthetic peptide located within the following region: FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF |
TMED1 mouse monoclonal antibody, clone OTI7D2 (formerly 7D2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TMED1 mouse monoclonal antibody, clone OTI7G4 (formerly 7G4)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".