Autoimmunity

Jump to Filters
View as table Download
IL1RL2 Rabbit Polyclonal Antibody
TA326663

USD 570.00

5 Days

Rabbit Polyclonal IL-1RL2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IL-1RL2 antibody was raised against a 16 amino acid peptide near the center of human IL-1RL2.
IL1RL2 Rabbit Polyclonal Antibody
TA339385

USD 539.00

5 Days

Rabbit Polyclonal Anti-IL1RL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL1RL2 antibody: synthetic peptide directed towards the N terminal of human IL1RL2. Synthetic peptide located within the following region: HVNLTVFEKHWCDTSIGGLPNLSDEYKQILHLGKDDSLTCHLHFPKSCVL