Adaptive Immunity

Jump to Filters
View as table Download
ISYNA1 Rabbit Polyclonal Antibody
TA335561

USD 539.00

5 Days

Rabbit Polyclonal Anti-ISYNA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ISYNA1 Antibody: synthetic peptide directed towards the N terminal of human ISYNA1. Synthetic peptide located within the following region: LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD